backround backroundleft
abouthosting
topspacerhomespacerwhmspacerrvskinspacercpanelspacercontactusspacer
welcometoourwebsitebanner
top

About cPanel

 

cPanel is one of, if not the largest control panel on the internet. If you are viewing this you are most likely using a Linux server. While there are other control panels that are out there, cPanel is one that you will see more often than not.

cPanel is developed by cPanel.net who also makes the Web Hosting Manager (WHM) control panel. You will often hear cPanel/WHM because they are the same software, even though you may never use WHM. Web Hosting Manager is used to control accounts and server based functions; whereas, cPanel is used to control a site.

cPanel is a great piece of software because it allows you to do an extraordinary amount of things with ease. As you can see to the right, there are 30 different things described that you can do from cPanel. The tutorials are for most, if not all of the major things you will want to do. As you learn more about cPanel you may do things not listed to the right.

There are also a lot of Skins out there for cPanel which make it easier for some people. The skin we are using in the tutorial is the standard one, X Skin.

We hope that the tutorials to the right will help you do everything that you want to do in cPanel. They cover the all important aspects such as creating an email account and adding an FTP account. There are also tutorials that show you how to do more detailed things such as creating a Cron Job.

top02
slogan

cPanel Tutorials

1. Adding an FTP Account Tutorial 16. Create a MySQL User Tutorial
2. Adding an Addon Domain Tutorial 17. Create a MySQL Database Tutorial
3. Creating an Autoresponder Tutorial 18. Setting Up MySQL Tutorial
4. Backing Up Your Website Tutorial 19. Viewing Server Status Tutorial
5. Setting a Catch-All Email Tutorial 20. Creating a Forwarder Tutorial
6. Changing Your Contact eMail Tutorial 21. Viewing Your FTP Information Tutorial
7. Creating a Folder Tutorial 22. Finding the Home Directory Tutorial
8. Creating an eMail Address Tutorial 23. Setting Up HotLink Protection Tutorial
9. Password Protecting a Directory Tutorial 24. View Disk Space Usage Tutorial
10. Creating a Cron Tab (Standard) Tutorial 25. Parking a Domain Tutorial
11. Creating a Cron Tab (Advanced) Tutorial 26. Changing your Password Tutorial
12. View Your Online Email Tutorial 27. Setting up a Redirection Tutorial
13. Download the Home Directory Tutorial 28. Uploading a File Tutorial
14. Create an Email Filter Tutorial 29. Creating a Subdomain Tutorial
15. Create a Custom Error Page Tutorial 30. Setting up Redirection for a Subdomain Tutorial

 

top04
       
backroundright backround