backround backroundleft
abouthosting
topspacerhomespacerwhmspacerrvskinspacercpanelspacercontactusspacer
welcometoourwebsitebanner
top

About RVSkin

 

RVSkin is a skin for the popular control panel cPanel. It is created by RVSkin.com

Not all companies will provide RVSkin. It is an addon for cPanel that some choose to employ for their customers. An example of a company that provides RVSkin is titanpages.com.

RVSkin is a lot like cPanel, seeing as it is really just another form of cPanel. It is however different, which is why just using cPanel tutorials won't really cut it.

There are two forms of RVSkin. There is RVSkin and RVSkinlight. The tutorials at the right are for RVSkin Blue (RVSkin has many different colors, blue is one of the most common and the color doesn't affect how the panel works). The reason we provide RVSkin Blue tutorials is because it is very common, and the most different from the cPanel X skins.

RVSkin organizes things in a fashion that may be more desirable for the user. In cPanel you have to click the mail button to see all the mail options. But, because email is such a major part of a website, RVSkin has designed their control panel to have the options on the front.

RVSkin is also seen as more user friendly. While many people prefer the X skins or another skin, a lot of people find RVSkin easier to use and they rather use RVSkin to the ones that come standard with cPanel

We hope you enjoy the tutorials.

top02
slogan

RVSkin Tutorials

1. Adding an FTP Account Tutorial 16. Creating a MySQL User Tutorial
2. Adding an Addon Domain Tutorial 17. Setting Up MySQL Tutorial
3. Backing Up Your Website Tutorial 18. Parking a Domain Tutorial
4. Changing Your Contact eMail Tutorial 19. Changing your Password Tutorial
5. Creating a Folder Tutorial 20. Setting up a Redirection Tutorial
6. Creating an eMail Address Tutorial 21. Uploading a File Tutorial
7. Password Protecting a Directory Tutorial 22. Create an Autoresponder Tutorial
8. Creating a Cron Tab (Advanced) Tutorial 23. Setup a Catch-All Email Tutorial
9. Creating a Cron Tab (Standard) Tutorial 24. View Used Diskspace Tutorial
10. First Logging Into RVSkin Tutorial 25. Download the Home Directory Tutorial
11. Creating a Forwarder Tutorial 26. Setup an Email Filter Tutorial
12. Viewing Your FTP Information Tutorial 27. Create a Custom Error Page Tutorial
13. Finding the Home Directory Tutorial 28. View PHP Information Tutorial
14. Setting Up HotLink Protection Tutorial 29. View Online Email Tutorial
15. Creating a MySQL Database Tutorial 30. Creating a Subdomain Tutorial
31. Setting up Redirection for a Subdomain Tutorial

 

top04
       
backroundright backround